ID Peptide Name Sequence Producer organism Target organism MIC value(μM) UniProt
Staph. P 1 L5K5WKKLLKWLKKLLsynthesizedStaphylococcus aureus ATCC 6538p4No entry Found
Staph. P 2 Grammistin Gs BIGGIISFFKRLFGrammistes sexlineatusStaphylococcus aureus3 P69839
Staph. P 3 Temporin-AFLPLIGRVLSGIL Rana temporaria(European red frog)Staphylococcus aureus2 P56917
Staph. P 4 Jellein-1PFKISIHLRoyal JellyS. aureus (ATCC 6535) 8No entry Found
Staph. P 5 Big defensinAVPDVAFNAYGRuditapes philippinarum (Japanese littleneck clam) (Venerupis philippinarum)Staphylococcus aureus6 P86316
Staph. P 6 Bac2A-NH2RLARIVVIRVARsynthesizedStaphylococcus aureus4No entry Found
Staph. P 7 ProtonectinILGTILGLLKGLAgelaia pallipesS. aureus (ATCC 6538)7 P69437
Staph. P 8 Polybia-CPILGTILGLLKSLPolybia paulistaStaphylococcus aureus (ATCC 6538)8 P0C1R0
Staph. P 9 IndolicinILPWKWPWWPWRRsynthesizedStaphylococcus aureus RN42208No entry Found
Staph. P 10 Odorranain-G1FMPILSCSRFKRCfrog Odorrana grahamiStaphylococcus aureus5 A6MBL7
Staph. P 11 Dybowskin 1CDYaIIPLPLGYFAKKTRana.dybowskii (frog)Staphylococcus aureus ATCC126006 B5A9S9
Staph. P 12 Grammistin Pp 1FIGGIISFFKRLFPogonoperca punctataStaphylococcus aureus IAM 10110,82 P69842
Staph. P 13 Temporin-1PFLPIVGKLLSGLLRana cascadae (frog)Staphylococcus aureus8 P82848
Staph. P 14 Temporin-1CSbFLPIIGKLLSGLLRana cascadae (frog)Staphylococcus aureus8No entry Found
Staph. P 15 temporin 10bFLPLIGKILGTILRana ornativentrisStaphylococcus aureus5No entry Found
Staph. P 16 Grammistin Pp 2bFIGGIISFIKKLFPogonoperca punctataStaphylococcus aureus IAM 10110,82 P69844
Staph. P 17 Temporin LFVQWFSKFLGRIL Rana temporaria (European red frog)Staphylococcus aureus Cowan I0,5 P57104
Staph. P 18 Temporin-BLLPIVGNLLKSLLRana temporariaStaphylococcus aureus3 P79874
Staph. P 19 Mastoparan-like peptide 12bINWKGIAAMKKLLVespa magnifica (Smith).Staphylococcus aureus (ATCC2592)4 P0C1M5
Staph. P 20 temporin-1Oa1FLPLLASLFSRLLRana ornativentris (frog)S. aureus (NCTC 8325),2No entry Found
Staph. P 21 temporin-1Oc1FLPLLASLFSRLFRana ornativentris (frog)S. aureus (NCTC 8325),2No entry Found
Staph. P 22 Temporin-PRbFLPIITNLLGKLLRana pretiosa(frog)Staphylococcus aureus6No entry Found
Staph. P 23 Temporin-1EcFLPVIAGLLSKLFRana esculenta ( frog) Staphylococcus aureus8No entry Found
Staph. P 24 BmKn2FIGAIARLLSKIFButhus martensii KarschStaphylococcus aureus0,3No entry Found
Staph. P 25 Temporin-1SaFLSGIVGMLGKLFspecimens of Pelophylax (Rana) saharica frogs (Beja, Tunisia)Staphylococcus aureus ATCC3 B3KYH4
Staph. P 26 IsCTf_4ILGKIWKGIKSLFOpisthacanthus madagascariensis (scorpion)Staphylococcus aureus1No entry Found
Staph. P 27 IsCTf_3ILGKILKGIKKLFOpisthacanthus madagascariensis (scorpion)Staphylococcus aureus2No entry Found
Staph. P 28 Odorranain-F1_2GFMDTAKNVAKNVAVTLLDNLKCKITKAC Odorrana grahami (frog)Staphylococcus aureus0,48No entry Found
Staph. P 29 Temporin-LTbFIITGLVRGLTKLFHylarana latouchii ( frog)Staphylococcus aureus(ATCC2592)6No entry Found
Staph. P 30 Hylaseptin-P1GILDAIKAIAKAAGAnuran Hyla punctataStaphylococcus aureus ATCC 259236 P84292
Staph. P 31 Mastoparan-like peptide 12aINWKGIAAMAKKLLVespa magnifica (Smith).Staphylococcus aureus(ATCC2592)4 P0C1M4
Staph. P 32 dhvar4KRLFKKLLFSLRKYBovine lactoferrin ( milk)Staphylococcus aureus(HG386),4No entry Found
Staph. P 33 Polybia-MPIIDWKKLLDAAKQILPolybia paulistaStaphylococcus aureus(ATCC 6538)7No entry Found
Staph. P 34 Mastoparan-like peptide 12dINLKAIAAMAKKLLVespa magnificaStaphylococcus aureus(ATCC2592)0,71 P0C5G7
Staph. P 35 Eumenine mastoparan-AFINLLKIAKGIIKSLAnterhynchium flavomarginatum micado.Staphylococcus aureus (ATCC 6538, ATCC 25923).2 P0C022
Staph. P 36 Dybowskin-4VWPLGLVICKALKICRana dybowskiiStaphylococcus aureus2No entry Found
Staph. P 37 Mastoparan-like peptide 12cINLKAIAALAKKLLGVespa magnificaStaphylococcus aureus(ATCC2592)1No entry Found
Staph. P 38 Citropin 1.1 M20GLFKVIKKVASVIGGL Litoria citropa (frog)Staphylococcus aureus3No entry Found
Staph. P 39 Amolopin-2aFLPIVGKLLSGLSGLLAmolops loloensisStaphylococcus aureus0,83 A0SN45
Staph. P 40 Citropin 1.1 M14GLFDVIAKVASVIKKL Litoria citropa (frog)Staphylococcus aureus3No entry Found
Staph. P 41 Citropin 1.1 M15GLFAVIKKVASVIKKL Litoria citropa (frog)Staphylococcus aureus3No entry Found
Staph. P 42 Tachyplesin-1KWCFRVCYRGICYRRCRT achypleus tridentatusStaphylococcus aureus 209, ATCC259235 P69136
Staph. P 43 Dybowskin-2FLIGMTQGLICLITRKCRana dybowskiiStaphylococcus aureus(KCTC38818No entry Found
Staph. P 44 CHRG07GIINTLQKYYSRVRGGRsynthesizedStaphylococcus aureus8No entry Found
Staph. P 45 Temporin-LtaFFPLVLGALGSILPKIFHylarana latouchiiStaphylococcus aureus ATCC2592)8 B8QSS5
Staph. P 46 Ala4-uperin 3.6GVIAAAKKVVNVLKNLFUperoleia mjobergiiStaphylococcus aureus8No entry Found
Staph. P 47 p-18_1KWKLFKKPKFLHLAKKFsynthesizedStaphylococcus aureus KCTC 16212No entry Found
Staph. P 48 CA-MA1KWKLFKKIKFLHSAKKFsynthesizedStaphylococcus aureus(KCTC cat. no. 1621)3No entry Found
Staph. P 49 protegrin 4RGGRLCYCRGWICFCVGRsynthesizedStaphylococcus aureus1No entry Found
Staph. P 50 Gomesin_2CRRLCYKQRCVTYCRGRAcanthoscurria gomesiana Hemocytes ( spider) Staphylococcus aureus2No entry Found
Staph. P 51 Gomesin_1ECRRLCYKQRCVTYCRGRAcanthoscurria gomesiana Hemocytes ( spider) Staphylococcus aureus2No entry Found
Staph. P 52 GomesinQCRRLCYKQRCVTYCRGRAcanthoscurria gomesiana (Spider ) Staphylococcus aureus2 P82358
Staph. P 53 Shuchin 2NALSSPRNKCDRASSCFGRana shuchinaeStaphylococcus aureus(ATCC2592)2No entry Found
Staph. P 54 Shuchin 1NALSMPRNKCNRALMCFGRana shuchinaeStaphylococcus aureus5No entry Found
Staph. P 55 Dybowskin-2CDYaSAVGRHGRRFGLRKHRKH Rana dybowskii ( frog,) Staphylococcus aureus ATCC12600)6 B5A9T1
Staph. P 56 Peptide BmKb1FLFSLIPSAISGLISAFKButhus martensii KarschStaphylococcus aureus6 Q718F4
Staph. P 57 MelectinGFLSILKKVLPKVMAHMKCleptoparasitic Bee Melecta albifronsStaphylococcus aureus7 P86170
Staph. P 58 BMAP-27 (1-18)GRFKRFRKKFKKLFKKLSsynthesizedStaphylococcus aureus(MRSA3No entry Found
Staph. P 59 ovispirin 1KNLRRIIRKIIHIIKKYGsynthesizedStaphylococcus aureus1No entry Found
Staph. P 60 novispirin G10KNLRRIIRKGIHIIKKYGsynthesizedStaphylococcus aureus5No entry Found
Staph. P 61 Phylloseptin-L1LLGMIPLAISAISALSKL Hylomantis lemur (frog)Staphylococcus aureus8No entry Found
Staph. P 62 CA-MA2KWKLFKKIPKFLHSAKKFsynthesizedStaphylococcus aureus(ATCC 25923)3No entry Found
Staph. P 63 S9-P18KWKLFKKISKFLHLAKKFsynthesizedStaphylococcus aureus(KCTC cat. no. 1621)6No entry Found
Staph. P 64 Hylin a1IFGAILPLALGALKNLIK Hypsiboas albopunctatus (frog)Staphylococcus aureus KCTC 16218 P85982
Staph. P 65 Parasin IKGRGKQGGKVRAKAKTRSSParasilurus asotusStaphylococcus aureus ATCC 157521No entry Found
Staph. P 66 27 kDa antibacterial proteinGIGGKPVQTAFVDNDGIYDCyprinus carpioStaphylococcus aureus2 P81925
Staph. P 67 styelin BGFGPAFHSVSNFAKKHKTAStyela clava.Staphylococcus aureus1 P81470
Staph. P 68 styelin AGFGKAFHSVSNFAKKHKTAStyela clava.Staphylococcus aureus1 P81469
Staph. P 69 Ascaphin-8GFKDLLKGAAKALVKTVLFAscaphus truei ( frog)Staphylococcus aureus6 P0CJ32
Staph. P 70 Phylloseptin-2FLSLIPHAINAVSTLVHHFPhyllomedusa hypochondriallis (frog)Staphylococcus aureus ATCC 29213,2 P84930
Staph. P 71 Phylloseptin-1_2FLSLIPHIVSGVASIAKHFPhyllomedusa hypochondriallis (frog)Staphylococcus aureus ATCC 292135No entry Found
Staph. P 72 Phylloseptin-1FLSLIPHAINAVSAIAKHNPhyllomedusa hypochondriallis (frog)Staphylococcus aureus ATCC 292134 P84566
Staph. P 73 L9-P18KWKLFKKILLKFLHLAKLFsynthesizedStaphylococcus aureus(KCTC cat. no. 1621)3No entry Found
Staph. P 74 Maximin H1ILGPVISTIGGVLGGLLKNLBombina maximaStaphylococcus aureus(ATCC2592)2No entry Found
Staph. P 75 Bactrocerin-1VGKTWIKVIRGIGKSKIKWQBactrocera dorsalis HENDELStaphylococcus aureus ATCC25923No entry Found
Staph. P 76 Maximin H7ILGPVIKTIGGVIGGLLKNLBombina ToadsStaphylococcus aureus(ATCC 25923),3No entry Found
Staph. P 77 Odorranain-B1AALKGCWTKSIPPKPCFGKROdorrana grahamiStaphylococcus aureus2No entry Found
Staph. P 78 Dybowskin-6FLPLLLAGLPLKLCFLFKKCRana dybowskiiStaphylococcus aureus6No entry Found
Staph. P 79 Maxinin H4ILGPVISKIGGVLGGLLKNLBombina maximaStaphylococcus aureus(ATCC2592),3No entry Found
Staph. P 80 Maximin H3ILGPVLGLVGNALGGLIKKIBombina maximaStaphylococcus aureus(ATCC2592),3No entry Found
Staph. P 81 Bombinin H5_1IIGPVLGLVGSALGGLLKKIBombina variegataStaphylococcus aureus Cowan 13No entry Found
Staph. P 82 Maximin H39ILGPVLGLVGNALGGLIKKLBombina ToadsStaphylococcus aureus(ATCC 25923),3No entry Found
Staph. P 83 Odorranain-J1GLFTLIKCAYQLIAPTVACNOdorrana grahamiStaphylococcus aureus6 A6MBN6
Staph. P 84 ParkerinGWANTLKNVAGGLCKITGAANanorana parkeri ( frog)Staphylococcus aureus9 D0ES75
Staph. P 85 Pilosulin-1GLGSVFGRLARILGRVIPKVMyrmecia pilosula ( ant)Staphylococcus aureus(710A)2 Q07932
Staph. P 86 Maximin H2ILGPVLSMVGSALGGLIKKIBombina maximaStaphylococcus aureus(ATCC2592),0,67No entry Found
Staph. P 87 RanalexinFLGGLIKIVPAMICAVTKKCRana catesbeiana Staphylococcus aureus4 P39084
Staph. P 88 CA-MA3KWKLFKKIGPGKFLHSAKKFsynthesizedStaphylococcus aureus (KCTC cat. no. 1621)3No entry Found
Staph. P 89 C18GLRKRLRKFRNKIKEKLKKIsynthesizedStaphylococcus aureus ATCC 259234No entry Found
Staph. P 90 C18AGLRKRLRKARNKIKEKLKKIsynthesizedStaphylococcus aureus ATCC 259238No entry Found
Staph. P 91 C18QGLRKRLRKFRNKIKQKLKKIsynthesizedStaphylococcus aureus ATCC 259234No entry Found
Staph. P 92 C18AAGLRKALRKFRNKIKEALKKIsynthesizedStaphylococcus aureus ATCC 259232No entry Found
Staph. P 93 CA-MAKWKLFKKIGIGKFLHSAKKFsynthesizedStaphylococcus aureus (KCTC cat. no. 1621)3No entry Found
Staph. P 94 HepcidinRCRFCCRCCPRMRGCGICCRFPseudosciaena croceaStaphylococcus aureus6 A1Z0M0
Staph. P 95 Nigrocin-OW1GILSGVLGMGKKIVCGLSGLCOdorous FrogsStaphylococcus aureus3No entry Found
Staph. P 96 Scolopin 1FLPKMSTKLRVPYRRGTKDYHcentipede venomsStaphylococcus aureus0,98 P0CH48
Staph. P 97 Odorranain-H1GIFGKILGVGKKVLCGLSGVCOdorrana grahami ( frog)Staphylococcus aureus2 A6MBL9
Staph. P 98 Odorranain-H1_1GIFGKILGVGKKVLCGLSGWCOdorrana grahami ( frog)Staphylococcus aureus2No entry Found
Staph. P 99 Nigrocin-OG21GLLSGVLGVGKKVDCGLSGLCOdorrana grahami ( frog)Staphylococcus aureus3No entry Found
Staph. P 100 Nigrocin-OG5GLLSGILGAGKQKVCGLSGLCOdorrana grahami ( frog)Staphylococcus aureus6No entry Found
Staph. P 101 Grahamin-1GLLSGILGAGKNIVCGLSGLCRana grahamiStaphylococcus aureus0,79 P85071
Staph. P 102 Nigrocin-OG13GLLSGILGAGKHIVCGLSGLKOdorrana grahami ( frog)Staphylococcus aureus3No entry Found
Staph. P 103 Buforin-2TRSSRAGLQFPVGRVHRLLRKBufo bufo gargarizansStaphylococcus aureus1No entry Found
Staph. P 104 MisgurinRQRVEELSKFSKKGAAARRRKMisgurnus anguillicaudatusStaphylococcus aureus4 P81474
Staph. P 105 Bombinin H5IIGPVLGLVGSALGGLLKKIGAmphibian SkinStaphylococcus aureus5 P82285
Staph. P 106 Bombinin H4_1LIGPVLGLVGSALGGLLKKIGAmphibian SkinStaphylococcus aureus4No entry Found
Staph. P 107 Maculatin-1.1GLFGVLAKVAAHVVPAIAEHFLitoria genimaculataStaphylococcus aureus3 P82066
Staph. P 108 KIAGKIAKIAGKIAKIAGKIAKIAGKIAsynthesizedStaphylococcus aureus(ATCC 29213),4No entry Found
Staph. P 109 KLAGLAKKLAGLAKKLAGLAKKLAGLAKsynthesizedStaphylococcus aureus(ATCC 29213),8No entry Found
Staph. P 110 Piscidin 1FFHHIFRGIVHVGKTIHRLVTGMorone saxatilis2M. chrysops)Staphylococcus aureus3No entry Found
Staph. P 111 Piscidin 3FIHHIFRGIVHAGRSIGRFLTGMorone saxatilis2M. chrysops)Staphylococcus aureus3 P0C006
Staph. P 112 Maximin 68GIGGALLSAGKAALKGLAKVLVBombina maxima and B. microdeladigitora,Staphylococcus aureus3No entry Found
Staph. P 113 Odorranain-W1GLFGKSSVWGRKYYVDLAGCAKAOdorrana grahamiStaphylococcus aureus2 A6MBS8
Staph. P 114 PMAP23RIIDLLWRVRRPQKPKFVTVWVRsynthesized Derived from Pig Myeloid CellStaphylococcus aureus4No entry Found
Staph. P 115 PBN2 KFGLVTSLIKGAGKLLGGLFGSVTGsynthesizedStaphylococcus aureus6No entry Found
Staph. P 116 Odorranin-HPGLLRASSVWGRKYYVDLAGCAKAOdorrana grahami (frog)Staphylococcus aureus1 A7YL71
Staph. P 117 Moronecidin_3FFHHIFRGIVHVGRTIHKLVTGGHybrid Striped BassStaphylococcus aureus2No entry Found
Staph. P 118 Moronecidin_4FFHHIFRGIVHVGRTIHRLVTGGHybrid Striped BassStaphylococcus aureus5No entry Found
Staph. P 119 Plasticin PD36KFGVVTDLLKTAGKLLGNLFGSLSGsynthesizedStaphylococcus aureus6No entry Found
Staph. P 120 Plasticin PD36KGVVTDLLKTAGKLLGNLVGSLSGsynthesizedStaphylococcus aureus6No entry Found
Staph. P 121 salivary glands defensinNCIQQCVSKGAQGGYCTNEKCTCYHaemaphysalis longicornisStaphylococcus aureus4 A4GUC4
Staph. P 122 Caerin-1.9GLFGVLGSIAKHVLPHVVPVIAEKLitoria chloris ( frog)Staphylococcus aureus3 P81252
Staph. P 123 Caerin 1.6GLFSVLGAVAKHVLPHVVPVIAEKLitoria chloris ( frog)Staphylococcus aureus2 P62547
Staph. P 124 Brevinin-1HSbFLPAVLRVAAQVVPTVFCAISKKCOdorrana hosii and Hylarana picturata ( frogs)Staphylococcus aureus3 P0C8S8
Staph. P 125 Caerin-1.8GLFKVLGSVAKHLLPHVVPVIAEKLitoria chloris ( frog)Staphylococcus aureus2 P81251
Staph. P 126 Brevinin-1HSaFLPAVLRVAAKIVPTVFCAISKKCOdorrana hosii and Hylarana picturata ( frogs)Staphylococcus aureus3 P0C8S7
Staph. P 127 Caerin 1.7GLFKVLGSVAKHLLPHVAPVIAEKLitoria chloris ( frog)Staphylococcus aureus9 P62549
Staph. P 128 Brevinin-1-OA2VIPFVASVAAEMMQHVYCAASKKCOdorous FrogsStaphylococcus aureus6No entry Found
Staph. P 129 Brevinin-1BeFLPAIVGAAAKFLPKIFCVISKKCRana luteiventris, Rana berlandieri and Rana pipiens ( frogs)Staphylococcus aureus3 P82837
Staph. P 130 Brevinin-1AUaFLPILAGLAAKLVPKVFCSITKKCRana aurora aurora (frog)Staphylococcus aureus(NCTC 8325)3No entry Found
Staph. P 131 Brevinin-1SYFLPVVAGLAAKVLPSIICAVTKKCRana sylvatica (frog)Staphylococcus aureus7 P82871
Staph. P 132 Brevinin-1BLcFLPIIAGIAAKFLPKIFCTISKKCLithobates blairi and Lithobates yavapaiensis ( frogs)Staphylococcus aureus2 B6CPR2
Staph. P 133 Brevinin-1AUbFLPILAGLAANILPKVFCSITKKC Rana aurora aurora ( frog)Staphylococcus aureus3No entry Found
Staph. P 134 Brevinin-1PaFLPIIAGVAAKVFPKIFCAISKKCRana luteiventris, Rana berlandieri and Rana pipiens ( frogs)Staphylococcus aureus7 P82841
Staph. P 135 Amolopin-1bFLPLAVSLAANFLPKLFCKITKKCAmolops loloensisStaphylococcus aureus2 A0SN42
Staph. P 136 Brevinin-1SPaFFPIIAGMAAKLIPSLFCKITKKCRana septentrionalis (frog)Staphylococcus aureus3No entry Found
Staph. P 137 Brevinin-1PbFLPIIAGIAAKVFPKIFCAISKKCRana luteiventris, Rana berlandieri and Rana pipiensStaphylococcus aureus5 A7YJD7
Staph. P 138 Brevinin-1BLaFLPAIVGAAAKFLPKIFCAISKKCLithobates blairi and Lithobates yavapaiensisStaphylococcus aureus2 B6CPR0
Staph. P 139 Ponericin L2LLKELWTKIKGAGKAVLGKIKGLL Pachycondyla goeldii (Ant)Staphylococcus aureus3 P82422
Staph. P 140 Brevinin-1BdFLPAIAGVAAKFLPKIFCAISKKC Rana luteiventris, Rana berlandieri and Rana pipiens (frogs)Staphylococcus aureus3 P82836
Staph. P 141 Brevinin-1BfFLPFIAGMAANFLPKIFCAISKKCRana luteiventris, Rana berlandieri and Rana pipiens ( frogs)Staphylococcus aureus8 P82838
Staph. P 142 Brevinin-1BaFLPFIAGMAAKFLPKIFCAISKKCRana luteiventris, Rana berlandieri and Rana pipiens ( frogs)Staphylococcus aureus2 P82833
Staph. P 143 Brevinin-1BbFLPAIAGMAAKFLPKIFCAISKKCRana luteiventris, Rana berlandieri and Rana pipiens ( frogs)Staphylococcus aureus1 P82834
Staph. P 144 Pandinin 2FWGALAKGALKLIPSLFSSFSKKD Pandinus imperator ( scropion)Staphylococcus aureus2 P83240
Staph. P 145 Brevinin-1CSaFLPILAGLAAKIVPKLFCLATKKCRana cascadae (R. aurora, R. boylii, R. draytonii, R.luteiventris, R. muscosa, and R. pretiosa( frog)Staphylococcus aureus2No entry Found
Staph. P 146 Brevinin-1BLpFLPLIAGLAANFLPKIFCAITKKCRana palustris (frog)Staphylococcus aureus9No entry Found
Staph. P 147 Brevinin-1PLcFLPVIAGVAAKFLPKIACAITKKCRana palustris (frog)Staphylococcus aureus4 A7WNV4
Staph. P 148 Brevinin-1EFLPLLAGLAANFLPKIFCKITRKCRana esculentaStaphylococcus aureus0,6 P32412
Staph. P 149 Brevinin-1PTaFMGGLIKAATKIVPAAYCAITKKCOdorrana hosii and Hylarana picturataStaphylococcus aureus3 P0C8T1
Staph. P 150 Brevinin-1LTaFFGTALKIAANVLPTAICKILKKCHylarana latouchii (frog)Staphylococcus aureus3 B8QSS4
Staph. P 151 EA-CATH1KRRGSVTTRYQFLMIHLLRPKKLFAEquus asinusStaphylococcus aureus0,2No entry Found
Staph. P 152 Caerin-1.5GLLSVLGSVVKHVIPHVVPVIAEHLsynthesized ( Litoria)Staphylococcus aureus7 P56230
Staph. P 153 Caerin-1.1GLLSVLGSVAKHVLPHVVPVIAEHLLitoria splendidaStaphylococcus aureus2 P62568
Staph. P 154 Carein 1,9GLFGVLGSIAKHVLPHVVPVIAEKLsynthesized ( Litoria)Staphylococcus aureus3No entry Found
Staph. P 155 Caerin 1.16GLFSVLGAVAKHVLPHVVPVIAEKLLitoria splendidaStaphylococcus aureus2 P86503
Staph. P 156 Caerin-1.18GLFSVLGSVAKHLLPHVVPVIAEKLLitoria gracilentaStaphylococcus aureus3 P0C2A7
Staph. P 157 Scolopin 2GILKKFMLHRGTKVYKMRTLSKRSHScolopendra subspinipes mutilansStaphylococcus aureus0,2 P0CH49
Staph. P 158 Carerin 1,8GLFKVLGSVAKHLLPHVVPVIAEKLsynthesizedStaphylococcus aureus2No entry Found
Staph. P 159 Caerin-1.17GLFSVLGSVAKHLLPHVAPIIAEKLsynthesizedStaphylococcus aureus8 P0C2A6
Staph. P 160 Caerin-1.19GLFKVLGSVAKHLLPHVAPIIAEKLLitoria gracilenta . Staphylococcus aureus3 P0C2A8
Staph. P 161 Dermaseptin-H13GLWSTIKNVGKEAAIAAGKAVLGSLPhyllomedusa hypochondrialis azureaStaphylococcus aureus0,5No entry Found
Staph. P 162 Maximin 77GIGGALLSAGKSALKGLAKGLAEHLBombina ToadsStaphylococcus aureus5No entry Found
Staph. P 163 Dermaseptin-H4GLWSTIKNVGKEAAIAAGKAALGALPhyllomedusa hypochondrialis azureaStaphylococcus aureus0,4 Q1EJP5
Staph. P 164 Ponericin W1WLGSALKIGAKLLPSVVGLFKKKKQPachycondyla goeldii ( Ant)Staphylococcus aureus CIP 677,LMA3 P82423
Staph. P 165 Bombinin-like peptides 3GIGAAILSAGKSALKGLAKGLAEHFBombina bombina and Bombina variegataStaphylococcus aureus2No entry Found
Staph. P 166 midgut defensinACHAHCQSVGRRGGYCGNFRMTCYCYHaemaphysalis longicornisStaphylococcus aureus4 A4GUC3
Staph. P 167 Dermaseptin-like PBN2 26GLVTSLIKGAGKLLGGLFGSVTGGQSPhyllomedusa bicolorStaphylococcus aureus3No entry Found
Staph. P 168 Pc-CATH1RIKRFWPVVIRTVVAGYNLYRAIKKKPhasianus colchicusStaphylococcus aureus2No entry Found
Staph. P 169 Pleurain-A2SIITMTKEAKLPQSWKQIACRLYNTCRana pleuradenStaphylococcus aureus ATCC25924 A8B5P0
Staph. P 170 Pleurain-A1SIITMTKEAKLPQLWKQIACRLYNTCRana pleuradenStaphylococcus aureus4 A8DY01
Staph. P 171 GuentherinVIDDLKKVAKKVRRELLCKKHHKKLNHylarana guentheriStaphylococcus aureus9 P84859
Staph. P 172 Maximin 39GIGTKFLGGVKTALKGALKELAFTYVNBombina ToadsStaphylococcus aureus5No entry Found
Staph. P 173 Maximin 2GIGTKILGGVKTALKGALKELASTYVNBombina maximaStaphylococcus aureus5No entry Found
Staph. P 174 Maximin 28GIGTKFLGGVKTALKGALKELASTYVNBombina ToadsStaphylococcus aureus1No entry Found
Staph. P 175 Maximin 1GIGTKILGGVKTALKGALKELASTYANBombina maximaStaphylococcus aureus5No entry Found
Staph. P 176 Maximin 63GIGGVLLGAGKATLKGLAKVLAEKYANBombina ToadsStaphylococcus aureus5No entry Found
Staph. P 177 Maximin 32GIGGKILGGLKTALKGAAKELASTYLHBombina ToadsStaphylococcus aureus2No entry Found
Staph. P 178 Maximin 5SIGAKILGGVKTFFKGALKELASTYLQBombina maximaStaphylococcus aureus0,9No entry Found
Staph. P 179 Maximin 45GIGGKILGGLRTALKGAAKELAATYLHBombina ToadsStaphylococcus aureus1No entry Found
Staph. P 180 Maximin 15GIGTKILGGVKAALKGALKELASTYVNBombina ToadsStaphylococcus aureus2No entry Found
Staph. P 181 Maximin 42SIGAKILGGVKTFFKGALKELAFTYLQBombina ToadsStaphylococcus aureus9No entry Found
Staph. P 182 Maximin 3GIGGKILSGLKTALKGAAKELASTYLHBombina maximaStaphylococcus aureus0,77No entry Found
Staph. P 183 Maximin 4GIGGVLLSAGKAALKGLAKVLAEKYANBombina maximaStaphylococcus aureus0,7No entry Found
Staph. P 184 Maximin 49GIGGVLLSAGKAALKGLTKVLAEKYANBombina ToadsStaphylococcus aureus5No entry Found
Staph. P 185 Bombinin-like peptides 1GIGASILSAGKSALKGLAKGLAEHFANRana esculentaStaphylococcus aureus3No entry Found
Staph. P 186 Bombinin-like peptide 2GIGSAILSAGKSALKGLAKGLAEHFANRanaStaphylococcus aureus1 P29003
Staph. P 187 Maximin 78GIGGALLSVGKLALKGLANVLADKFANBombina ToadsStaphylococcus aureus1No entry Found
Staph. P 188 OdM1ATAWDFGPHGLLPIRPIRIRPLCGKDKSOdorrana grahamiStaphylococcus aureus1No entry Found
Staph. P 189 Ranatuerin 2BGLLDTIKGVAKTVAASMLDKLKCKISGCRana berlandieri Staphylococcus aureus(NCTC 8325)2 P82840
Staph. P 190 Dermaseptin-B4ALWKDILKNVGKAAGKAVLNTVTDMVNQsynthesizedStaphylococcus aureus3 P81486
Staph. P 191 Dermaseptin-B3_1ALWKNMLKGIGKLAGQAALGAVKTLVGAsynthesizedStaphylococcus aureus1No entry Found
Staph. P 192 Dermadistinctin-LALWKTLLKNVGKAAGKAALNAVTDMVNQPhyllomedusa distincta ( frog)Staphylococcus aureus1 P83639
Staph. P 193 Kalata-B1GLPVCGETCVGGTCNTPGCTCSWPVCTRNsynthesizedStaphylococcus aureus0,26No entry Found
Staph. P 194 Enkelytin_1FAEPLPSEEEGESYSKEVPEMEKRYGGFMfresh bovine adrenal glandsStaphylococcus aureus4No entry Found
Staph. P 195 Odorranain-F1_1GFMDTAKNVAKNVAVTLIDNLKCKITKACOdorrana grahamiStaphylococcus aureus0,48No entry Found
Staph. P 196 Odorranain-F1GFMDTAKNAAKNVAVTLLDNLKCKITKACOdorrana grahamiStaphylococcus aureus0,48 A6MBL3
Staph. P 197 DS 01GLWSTIKQKGKEAAIAAAKAAGQAALGALPhyllomedusa oreadesStaphylococcus aureus8No entry Found
Staph. P 198 Dermaseptin-B3ALWKNMLKGIGKLAGQAALGAVKTLVGAEPhyllomedusa bicolorStaphylococcus aureus1 P81485
Staph. P 199 Circulin-AGIPCGESCVWIPCISAALGCSCKNKVCYRNsynthesizedStaphylococcus aureus0,2 P56871
Staph. P 200 GNCP-2_1RCICTTRTCRFPYRRLGTCLFQNRVYTFCCgranules ( animals) Staphylococcus aureus1No entry Found
Staph. P 201 Brevinin-2GHcIWEGIKNAGKGFLVSILDKVRCKVAGGCNPHylarana guentheriStaphylococcus aureus3 A0AEI6
Staph. P 202 Cathelicidin-BFKFFRKLKKSVKKRAKEFFKKPRVIGVSIPFBungarus fasciatusStaphylococcus aureus5No entry Found
Staph. P 203 Brevinin-2GHbGVITDALKGAAKTVAAELLRKAHCKLTNSCHylarana guentheriStaphylococcus aureus4 A0AEI5
Staph. P 204 Dermadistinctin-Q1ALWKNMLKGIGKLAGQAALGAVKTLVGAESPhyllomedusa distinctaStaphylococcus aureus3 P83641
Staph. P 205 Brevinin-2GHc_1SIWEGIKNAGKGFLVSILDKVRCKVAGGCNPHylarana guentheriStaphylococcus aureus2No entry Found
Staph. P 206 Odorranain-E1GLGGAKKNFIIAANKTAPQSVKKTFSCKLYNGOdorrana grahamiStaphylococcus aureus0,98 A6MBK8
Staph. P 207 bPcAPIIKVPLKKFKSMREVMRDHGIKAPVVDPATKYRana catesbeianaStaphylococcus aureus2No entry Found
Staph. P 208 Ranatuerin-2LbGILSSIKGVAKGVAKNVAAQLLDTLKCKITGCRana luteiventrisStaphylococcus aureus4 P82829
Staph. P 209 Rugosin-AGLLNTFKDWAISIAKGAGKGVLTTLSCKLDKSCRana rugosa ( frog)Staphylococcus aureus1 P80954
Staph. P 210 Dybowskin-3GLFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGCRana dybowskiiStaphylococcus aureus9No entry Found
Staph. P 211 Brevinin 20bGIFNVFKGALKTAGKHVAGSLLNQLKCKVSGECRana ornativentrisStaphylococcus aureus9No entry Found
Staph. P 212 Odorranain-C1GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDCOdorrana grahamiStaphylococcus aureus0,83 A6MBF6
Staph. P 213 Brevinin-2GLLDSLKGFAATAGKGVLQSLLSTASCKLAKTCRana Brivipoda porsaStaphylococcus aureus2 P32424
Staph. P 214 Brevinin-2PTbGFKGAFKNVMFGIAKSAGKSALNALACKIDKSCHylarana picturataStaphylococcus aureus9 P0C8T4
Staph. P 215 Rugosin-BSLFSLIKAGAKFLGKNLLKQGAQYAACKVSKECRana rugosaStaphylococcus aureus1 P80955
Staph. P 216 Dermadistinctin-KGLWSKIKAAGKEAAKAAAKAAGKAALNAVSEAVPhyllomedusa distinctaStaphylococcus aureus5 P83638
Staph. P 217 Brevinin-2GHaGFSSLFKAGAKYLLKSVGKAGAQQLACKAANNCAHylarana guentheriStaphylococcus aureus3 P84860
Staph. P 218 Cupiennin 1aGFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQMECupiennius salei ( spider)Staphylococcus aureus0,5 P83619
Staph. P 219 Cupiennin 1dGFGSLFKFLAKKVAKTVAKQAAKQGAKYVANKHMECupiennius salei ( spider)Staphylococcus aureus0,5 P83622
Staph. P 220 hBD3YCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKKsynthesizedStaphylococcus aureus4No entry Found
Staph. P 221 Pilosulin-4FDITKLNIKKLTKATCKVISKGASMCKVLFDKKKQEMyrmecia pilosulaStaphylococcus aureus6 Q68Y22
Staph. P 222 Dybowskin-5GLFSVVTGVLKAVGKNVAKNVGGSLLEQLKCKISGGCRana dybowskiiStaphylococcus aureus7No entry Found
Staph. P 223 LL-37_1LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESsynthesizedStaphylococcus aureus4No entry Found
Staph. P 224 pobRL-37RLGNFFRKAKKKIGRGLKKIGQKIKDFLGNLVPRTESbiosynthesizedStaphylococcus aureus1No entry Found
Staph. P 225 Esculentin-2SGLFTLIKGAVKMIGKTVAKEAGKTGLELMACKVTNQCbiosynthesizedStaphylococcus aureus3 Q1MU20
Staph. P 226 Esculentin-2-OA3GLFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQCodorous frogsStaphylococcus aureus0,92No entry Found
Staph. P 227 Esculentin-2PRa_1GVFSFLKTGAKLLGSTLLKMAGKAGAEHLACKATNQCRana pretiosaStaphylococcus aureus6No entry Found
Staph. P 228 Esculentin-2AGILSLVKGVAKLAGKGLAKEGGKFGLELIACKIAKQCRana esculentaStaphylococcus aureus0,8 P40845
Staph. P 229 hBD3KYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKKHuman ?-defensin 3Staphylococcus aureus4No entry Found
Staph. P 230 TAPNPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKKthe bovine tracheal mucosaStaphylococcus aureus7No entry Found
Staph. P 231 Spheniscin-2SFGLCRLRRGFCARGRCRFPSIPIGRCSRFVQCCRRVWAptenodytes patagonicusStaphylococcus aureus2 P83430
Staph. P 232 Buforin-1AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNYBufo bufo gargarizansStaphylococcus aureus0,68No entry Found
Staph. P 233 CHP1GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIRavian heterophilsStaphylococcus aureus0,12No entry Found
Staph. P 234 Odorranain-k1GLFTLIKGAAKLIGKTVPKKQARLGMNLWLVKLPTNVKTOdorrana grahamiStaphylococcus aureus0,8 A6MBN8
Staph. P 235 Beta-amyloid peptide (1-40)DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVmammalianStaphylococcus aureus4No entry Found
Staph. P 236 Cathelicidin-B1PIRNWWIRIWEWLNGIRKRLRQRSPFYVRGHLNVTSTPQPmucosal M cell gatewayStaphylococcus aureus1 Q6QLQ5
Staph. P 237 Defensin-A_1ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCRNAedes aegyptiStaphylococcus aureus1 P0C8A1
Staph. P 238 Anopheles defensinATCDLASGFGVGSSLCAAHCIARRYRGGYCNSKAVCVCRNFly PhlebotomusStaphylococcus aureus0,6No entry Found
Staph. P 239 Phlebotomus defensin ATCDLLSAFGVGHAACAAHCIGHGYRGGYCNSKAVCTCRRFly PhlebotomusStaphylococcus aureus1No entry Found
Staph. P 240 ADP-2YENPYGCPTDEGKCFDRCNDSEFEGGYCGGSYRATCVCYRTAmblyomma hebraeumStaphylococcus aureus8No entry Found
Staph. P 241 Moricin 2AKIPIKAIKTVGKAVGKGLRAINIASTANDVFNFLKPKKRKHBombyx mori ( Silkworm) Staphylococcus aureus0,3 O96059
Staph. P 242 Cg-DefGFCCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKKOyster Crassostrea gigasStaphylococcus aureus2No entry Found
Staph. P 243 Pandinin-1GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPTPandinus imperator (scorpion)Staphylococcus aureus3 P83239
Staph. P 244 ISAMPPDPGQPWQVKAGRPPCYSIPCRKHDECRVGSCSRCNNGLWGDRTCRIxodes scapularis ( salivery)Staphylococcus aureus2 Q8MVA6
Staph. P 245 Esculentin-1AGIFSKLAGKKIKNLLISGLKNVGKEVGMDVVRTGIDIAGCKIKGECRana esculentaStaphylococcus aureus0,4 P40843
Staph. P 246 Chicken AvBD7QPFIPRPIDTCRLRNGICFPGICRRPYYWIGTCNNGIGSCCARGWRSchickensStaphylococcus aureus0,11No entry Found
Staph. P 247 royalisinVTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKVGCICRKTSFKDLWDKRF(Apis melliferaStaphylococcus aureus2 E2BT13
Staph. P 248 Enterocin E-760NRWYCNSAAGGVGGAAVCGLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWASGenterococci ( bacteria)Staphylococcus aureus0,17 P85147
Staph. P 249 MB_10GESLASKAAKAAERMolecular Design methodologyStaphylococcus aureus0,78No entry Found
Staph. P 250 MB_22GWLLLEYIPVIAALMolecular Design methodologyStaphylococcus aureus0,54No entry Found
Staph. P 251 MB_03VSSKYLSKVKVKAGKMolecular Design methodologyStaphylococcus aureus4No entry Found
Staph. P 252 MB_04ARLAKKALRRLAKKDMolecular Design methodologyStaphylococcus aureus1No entry Found
Staph. P 253 MB_18LKALKKLAKKLKKLAMolecular Design methodologyStaphylococcus aureus7No entry Found
Staph. P 254 MB_31EAALKAALDLAAKLAMolecular Design methodologyStaphylococcus aureus0,75No entry Found
Staph. P 255 MB_00LKLLKKLLKKLKKLLMolecular Design methodologyStaphylococcus aureus7No entry Found
Staph. P 256 MB_25LSSALSALSSALSSKMolecular Design methodologyStaphylococcus aureus0,54No entry Found
Staph. P 257 MB_32ERSAAKSAARSLARRMolecular Design methodologyStaphylococcus aureus0,67No entry Found
Staph. P 258 MB_33EKTLARTAAKTALKKMolecular Design methodologyStaphylococcus aureus0,43No entry Found
Staph. P 259 MB_35VSSKYLSKALVKAGRMolecular Design methodologyStaphylococcus aureus0,54No entry Found
Staph. P 260 CM-1LALLKVLLRKIKKALMolecular Design methodologyStaphylococcus aureus6No entry Found
Staph. P 261 CM-2LLLLKILLLKKLKAMolecular Design methodologyStaphylococcus aureus3No entry Found
Staph. P 262 MB_15ESLAKALSKEALKALKMolecular Design methodologyStaphylococcus aureus1No entry Found
Staph. P 263 MB_34EKAAAKSAAAKTLARRMolecular Design methodologyStaphylococcus aureus0,43No entry Found
Staph. P 264 MC-04LLKKLLRAASKALSLLMolecular Design methodologyStaphylococcus aureus6No entry Found
Staph. P 265 MC-05AAKKLSKLLKTLLKLLMolecular Design methodologyStaphylococcus aureus6No entry Found
Staph. P 266 MC-08KALKKLLKLASSLLTALMolecular Design methodologyStaphylococcus aureus6No entry Found
Staph. P 267 MB-37FASLLGKLAKKLAKKALKMolecular Design methodologyStaphylococcus aureus6No entry Found
Staph. P 268 MB-38ESLKARSLKKSLKLKKLLMolecular Design methodologyStaphylococcus aureus2No entry Found
Staph. P 269 MB-41ELAKKALKALKKALKSARMolecular Design methodologyStaphylococcus aureus4No entry Found
Staph. P 270 MB-43ELAKKALRALKKALKSAKMolecular Design methodologyStaphylococcus aureus3No entry Found
Staph. P 271 MB-45ETFAKKALKALEKLLKKGMolecular Design methodologyStaphylococcus aureus3No entry Found
Staph. P 272 CM-4LLAILLLALLALRKKVLAMolecular Design methodologyStaphylococcus aureus0,99No entry Found
Staph. P 273 MB-40ETELAKKALKALKLKKLAMolecular Design methodologyStaphylococcus aureus0,47No entry Found
Staph. P 274 MB-47QKAASRLLRALSKLLEAFMolecular Design methodologyStaphylococcus aureus6No entry Found
Staph. P 275 MB-48QKALAKLAKKALKALAKQMolecular Design methodologyStaphylococcus aureus1No entry Found
Staph. P 276 MB-50ESKAAKAAKKAAKAKASEMolecular Design methodologyStaphylococcus aureus0,24No entry Found
Staph. P 277 MC-10AASKALRTASRLARSLLTMolecular Design methodologyStaphylococcus aureus6No entry Found
Staph. P 278 MB-36FASLLGKALKALLAKLAKQMolecular Design methodologyStaphylococcus aureus6No entry Found
Staph. P 279 MB-46ESSLKKKALSKLSKLLKKGMolecular Design methodologyStaphylococcus aureus3No entry Found
Staph. P 280 MC-03AASKAAKTLAKLLSSLLKLMolecular Design methodologyStaphylococcus aureus6No entry Found
Staph. P 281 Odorranain-F-OR1GFMDTAKNVAKNVAATLLDKLKCKITGGCsynthesizedStaphylococcus aureus2No entry Found
Staph. P 282 PuroAFPVTWRWWKWWKGbiosynthesizedStaphylococcus aureus8No entry Found
Staph. P 283 Pina-MFSVTWRWWKWWKGsynthesizedStaphylococcus aureus7No entry Found
Staph. P 284 Temporin-LteFLAGLIGGLAKMLHylarana latouchiiStaphylococcus aureus10 G5CKS1
Staph. P 285 Brevinin-2LTaGAFGDLLKGVAKEAGMKLLNMAQCKLSGKCHylarana latouchiiStaphylococcus aureus2 B9W1P6
Staph. P 286 Palustrin-2LTaSLWENFKNAGKQFILNILDKIRCRVAGGCRTHylarana latouchiiStaphylococcus aureus2 B9W1Q2
Staph. P 287 Brevinin-2LTbSILDKIKNVALGVARGAGTGILKALLCKLDKSCHylarana latouchiiStaphylococcus aureus4 B9W1P9
Staph. P 288 Esculentin-2LTaMFTMKKSMLLIVLLGIISLSLCEQERNADEDEQSEMHylarana latouchiiStaphylococcus aureus2 B9W1Q0
Staph. P 289 synthetic 19L-30R-NH2 fragment_10HCLAIGRRAllomyrina dichotomaStaphylococcus aureus8No entry Found
Staph. P 290 synthetic 19L-30R-NH2 fragment_9AHCLAIGRRAllomyrina dichotomaStaphylococcus aureus4No entry Found
Staph. P 291 synthetic 22A 30R-NH2 fragment_1ALRLAIRRRAllomyrina dichotomaStaphylococcus aureus2No entry Found
Staph. P 292 synthetic 22A 30R-NH2 fragment_2ALLLAIRRRAllomyrina dichotomaStaphylococcus aureus2No entry Found
Staph. P 293 synthetic 22A 30R-NH2 fragment_3AWLLAIRRRAllomyrina dichotomaStaphylococcus aureus2No entry Found
Staph. P 294 synthetic 22A 30R-NH2 fragment_4ALYLAIRRRAllomyrina dichotomaStaphylococcus aureus1No entry Found
Staph. P 295 synthetic 22A-30R-NH2 fragment_5ALWLAIRRRAllomyrina dichotomaStaphylococcus aureus2No entry Found
Staph. P 296 synthetic 19L-30R-NH2 fragment_8AAHCLAIGRRAllomyrina dichotomaStaphylococcus aureus3No entry Found
Staph. P 297 synthetic 19L-30R-NH2 fragment_2LCAAHCLAIRRRAllomyrina dichotomaStaphylococcus aureus4No entry Found
Staph. P 298 synthetic 19L-30R-NH2 fragment_3LCAAHCLAILRRAllomyrina dichotomaStaphylococcus aureus6No entry Found
Staph. P 299 synthetic 19L-30R-NH2 fragment_4LCAARCLAIGRRAllomyrina dichotomaStaphylococcus aureus4No entry Found
Staph. P 300 synthetic 19L-30R-NH2 fragment_5LCAALCLAIGRRAllomyrina dichotomaStaphylococcus aureus3No entry Found
Staph. P 301 synthetic 19L-30R-NH2 fragment_6LRAAHRLAIGRRAllomyrina dichotomaStaphylococcus aureus3No entry Found
Staph. P 302 synthetic 19L-30R-NH2 fragment_7LLAAHLLAIGRRAllomyrina dichotomaStaphylococcus aureus6No entry Found
Staph. P 303 Temporin-AliFFPIVGKLLSGLLAmolops loloensisStaphylococcus aureus4No entry Found
Staph. P 304 Temporin-AljFFPIVGKLLFGLLAmolops loloensisStaphylococcus aureus4No entry Found
Staph. P 305 temporin-HN2NILNTIINLAKKILOdorrana hainanensisStaphylococcus aureus5 E7EKD4
Staph. P 306 Andersonin-D1FIFPKKNIINSLFGRodorous frogsStaphylococcus aureus7No entry Found
Staph. P 307 Temporin-1CEeILPIIGKILSTIFGKRana chensinensisStaphylococcus aureus6No entry Found
Staph. P 308 Temporin-AldFLPIAGKLLSGLSGLLAmolops loloensisStaphylococcus aureus0,52No entry Found
Staph. P 309 Temporin-AleFFPIVGKLLFGLSGLLAmolops loloensisStaphylococcus aureus0,52No entry Found
Staph. P 310 Temporin-AlfFFPIVGKLLSGLSGLLAmolops loloensisStaphylococcus aureus1No entry Found
Staph. P 311 Temporin-AlgFFPIVGKLLFGLFGLLAmolops loloensisStaphylococcus aureus1No entry Found
Staph. P 312 Temporin-AlhFLPIVGKLLSGLSGLSAmolops loloensisStaphylococcus aureus1No entry Found
Staph. P 313 Nigroain-E1DCTRWIIGINGRICRDRana nigrovittataStaphylococcus aureus8No entry Found
Staph. P 314 Brevinin-1DaILPLLLGKVVCAITKKCRana dalmatinaStaphylococcus aureus7No entry Found
Staph. P 315 Andersonin-W2AVNIPFKVHFRCKAAFCodorous frogsStaphylococcus aureus4 E3SZR8
Staph. P 316 Temporin-RN3FFPLLFGALSSHLPKLFRana nigrovittataStaphylococcus aureus1No entry Found
Staph. P 317 Temporin-RN1FLPLVLGALSGILPKILRana nigrovittataStaphylococcus aureus2No entry Found
Staph. P 318 CPF-PG1GFGSLLGKALKIGTNLLXenopus pygmaues Staphylococcus aureus6No entry Found
Staph. P 319 AamAP-S1FLFSLIPKAIGGLISAFKAndroctonus amoreuxi (venom of the North African scorpion)Staphylococcus aureus3No entry Found
Staph. P 320 Andersonin-Y1FLPKLFAKITKKNMAHIRodorous frogsStaphylococcus aureus0,59No entry Found
Staph. P 321 IG-19IGKEFKRIVQRIKDFLRNLsynthesized Staphylococcus aureus4No entry Found
Staph. P 322 a1IGKKFKRIVQRIKDFLRNLsynthesized Staphylococcus aureus4No entry Found
Staph. P 323 a2IGKKFKRIVQRIKKFLRNLsynthesized Staphylococcus aureus4No entry Found
Staph. P 324 a3IGKKFKRIVQRIKKFLRKLsynthesized Staphylococcus aureus4No entry Found
Staph. P 325 a4IGKKFKRIVKRIKKFLRKLsynthesized Staphylococcus aureus4No entry Found
Staph. P 326 a5IGKLFKRIVQRIKKFLRNLsynthesized Staphylococcus aureus8No entry Found
Staph. P 327 a6IGKLFKRIVQRILKFLRNLsynthesized Staphylococcus aureus8No entry Found
Staph. P 328 a7IGKLFKRIVKRILKFLRKLsynthesized Staphylococcus aureus4No entry Found
Staph. P 329 a8ILKLFKRIVKRILKFLRKLsynthesized Staphylococcus aureus8No entry Found
Staph. P 330 a4-W1IGKKWKRIVKRIKKFLRKLsynthesized Staphylococcus aureus4No entry Found
Staph. P 331 a4-W2IGKKFKRIVKRIKKWLRKLsynthesized Staphylococcus aureus2No entry Found
Staph. P 332 PS-3FLSLIPHAINAVSALANHGPhyllomedusa frogsStaphylococcus aureus4No entry Found
Staph. P 333 CancrinGSAQPYKQLHKVVNWDPYGRana cancrivoraStaphylococcus aureus5No entry Found
Staph. P 334 Ranacyclin-B-RL1AALRGCWTKSIPPKPCPGKRRanidae amphibian skinsStaphylococcus aureus6No entry Found
Staph. P 335 Ranacyclin B5AALRGCWTKSIPPKPCSGKRRanidae amphibian skinsStaphylococcus aureus6No entry Found
Staph. P 336 Esculentin-2-OR6QVFTLIKGATQLIRKTLGEQodorous frogsStaphylococcus aureus3No entry Found
Staph. P 337 Odorranain-J-OA1GLFTLIKGAYKLDAPTVACNodorous frogsStaphylococcus aureus7No entry Found
Staph. P 338 Odorranain-J-OA2GLFTLIKGAYKNDAPTVACNodorous frogsStaphylococcus aureus4No entry Found
Staph. P 339 Andersonin-X1GLFSKFAGKGIVNFLIEGVEodorous frogsStaphylococcus aureus5No entry Found
Staph. P 340 RL5WPVVIRTVVAGYNLYRAIKKKPhasianus colchicusStaphylococcus aureus4No entry Found
Staph. P 341 Buforin IibRAGLQFPVGRLLRRLLRRLLRsynthesizedStaphylococcus aureus0,63No entry Found
Staph. P 342 Buf IIIaRAGLQWPIGRLLRRLLRRLLRsynthesizedStaphylococcus aureus0,32No entry Found
Staph. P 343 Buf IIIbRVVRQWPIGRVVRRVVRRVVRsynthesizedStaphylococcus aureus0,32No entry Found
Staph. P 344 Buf IIIcKLLKQWPIGKLLKKLLKKLLKsynthesizedStaphylococcus aureus0,16No entry Found
Staph. P 345 Buf IIIdKVVKQWPIGKVVKKVVKKVVKsynthesizedStaphylococcus aureus0,32No entry Found
Staph. P 346 Hainanenin-1FALGAVTKLLPSLLCMITRKCAmolops hainanensisStaphylococcus aureus1No entry Found
Staph. P 347 Hainanenin-5FALGAVTKRLPSLFCLITRKCAmolops hainanensisStaphylococcus aureus0,73No entry Found
Staph. P 348 Nigrocin-OA1GLLSGVLGVGKKIVCGLSGLCOdorous andersoniiStaphylococcus aureus3No entry Found
Staph. P 349 Nigrocin-OA2GIFGKILGVGKKTLCELSGMCOdorous andersoniiStaphylococcus aureus2No entry Found
Staph. P 350 Nigrocin-OA3GIFLKVLGVGKKVLCGVSGLCOdorous andersoniiStaphylococcus aureus2No entry Found
Staph. P 351 Nigrocin-OR1GILSGILGVGKKLVCGLSGLCOdorous andersoniiStaphylococcus aureus2No entry Found
Staph. P 352 Nigrocin-OR2GILSGILGVGKMLVCGLSGLCOdorous andersoniiStaphylococcus aureus3No entry Found
Staph. P 353 Nigrocin-OR3GILSGLLGVGKMLVCGLSGLCOdorous andersoniiStaphylococcus aureus6No entry Found
Staph. P 354 Nigrocin-OW2GILGNIVGMGKKIVCGLSGLCOdorous andersoniiStaphylococcus aureus2No entry Found
Staph. P 355 Nigrocin-OW3GILGNIVGMGKKVVCGLSGLCOdorous andersoniiStaphylococcus aureus4No entry Found
Staph. P 356 Nigrocin-OW4GILSGVLGMGKKIVCGLRGLCOdorous andersoniiStaphylococcus aureus1No entry Found
Staph. P 357 Nigrocin-OW5GILGNIVGMGKQVVCGLSGLCOdorous andersoniiStaphylococcus aureus2No entry Found
Staph. P 358 RL4FWPVVIRTVVAGYNLYRAIKKKPhasianus colchicusStaphylococcus aureus1No entry Found
Staph. P 359 Nigroain-K1SLWETIKNAGKGFIQNILDKIRRana nigrovittata( frog)Staphylococcus aureus3No entry Found
Staph. P 360 RL3RFWPVVIRTVVAGYNLYRAIKKKPhasianus colchicusStaphylococcus aureus0,34No entry Found
Staph. P 361 Brevinin-1TOaGIGSILGVIAKGLPTLISWIKNRRana tagoi okiensisStaphylococcus aureus5 D5MTH2
Staph. P 362 Brevinin-1-OR1LPFVAGVAAEMMQHVYCAASKKCskins of Chinese odorous frogsStaphylococcus aureus3No entry Found
Staph. P 363 Brevinin-1-OR11LAFVAGVAAEMMQHVYCAASKKCskins of Chinese odorous frogsStaphylococcus aureus4No entry Found
Staph. P 364 brevinin-1HN1FLPLIASLAANFVPKIFCKITKKCOdorrana hainanensis ( frog)Staphylococcus aureus1 E7EKC4
Staph. P 365 Brevinin-1VFLPLIASVAANLVPKIFCKITKKCOdorrana hainanensis ( frog)Staphylococcus aureus2 E7EKC5
Staph. P 366 LR3RIKRFWPVVIRTVVAGYNLYRAIKPhasianus colchicusStaphylococcus aureus2No entry Found
Staph. P 367 RL2KRFWPVVIRTVVAGYNLYRAIKKKPhasianus colchicusStaphylococcus aureus0,98No entry Found
Staph. P 368 Brevinin-1CHaFLPIIAGVAAKVLPKLFCAITKKCLithobates chiricahuensis (Ranidae)Staphylococcus aureus2 A7YJE2
Staph. P 369 Brevinin-1CHbFLPVIAGLAAKVLPKLFCAITKKCLithobates chiricahuensis (Ranidae)Staphylococcus aureus2 A7YJE4
Staph. P 370 Brevinin-1-OA1VIVFVASVAAEMMQHVYCAASKKCOdorous FrogsStaphylococcus aureus3No entry Found
Staph. P 371 Brevinin-1-OA12FLPAVIRVAANVLPTAFCAISKKCOdorous FrogsStaphylococcus aureus2No entry Found
Staph. P 372 Brevinin-1-OR2ILPFVAGVAAEMMQHVYCAASKKCOdorous FrogsStaphylococcus aureus3No entry Found
Staph. P 373 Brevinin-1-OR3IDPFVAGVAAEMMQHVYCAASKKCOdorous FrogsStaphylococcus aureus5No entry Found
Staph. P 374 Brevinin-1-OR4INPFVAGVAAEMMQHVYCAASKKCOdorous FrogsStaphylococcus aureus2No entry Found
Staph. P 375 Brevinin-1-OR5ILPFVAGVAAEMMKHVYCAASKKCOdorous FrogsStaphylococcus aureus4No entry Found
Staph. P 376 Brevinin-1-OR6IIPFVAGVAAEMMEHVYCAASKKCOdorous FrogsStaphylococcus aureus6No entry Found
Staph. P 377 Brevinin-1-OR7QLPFVAGVACEMCQCVYCAASKKCOdorous FrogsStaphylococcus aureus3No entry Found
Staph. P 378 Brevinin-1-OR8ILPFVAGVAAEMMEHVYCAASKKCOdorous FrogsStaphylococcus aureus7No entry Found
Staph. P 381 Brevinin-1-OR9ILPFVAGVAAMEMEHVYCAASKKCOdorous FrogsStaphylococcus aureus1No entry Found
Staph. P 382 Brevinin-1-OR10FLPAVLLVATHVLPTVFCAITRKCOdorous FrogsStaphylococcus aureus2 D1MIZ4
Staph. P 381 Gaegurin-RN1FIGPVLKIAAGILPTAICKIFKKCRana nigrovittata ( frog) Staphylococcus aureus0,65No entry Found
Staph. P 382 Brevinin-1RTaFLPLLAGVVANFLPQIICKIARKCAmolops ricketti (Ranidae)Staphylococcus aureus2 D1MIZ4
Staph. P 383 Brevinin-1RTbFLGSLLGLVGKVVPTLFCKISKKCAmolops ricketti (Ranidae)Staphylococcus aureus0,86 D1MIZ6
Staph. P 384 Brevinin-1VLaFLGAIAGVAAKFLPKVFCFITKKCLithobates vaillanti (Ranidae)Staphylococcus aureus3No entry Found
Staph. P 385 Brevinin-1VLcFLPVIASVAAKVLPKVFCFITKKCLithobates vaillanti (Ranidae)Staphylococcus aureus2No entry Found
Staph. P 386 Brevinin-1VLdFLPLIAGVAANFLPKIFCLISKKCLithobates vaillanti (Ranidae)Staphylococcus aureus3No entry Found
Staph. P 387 Brevinin-1VLeFLPLIAGVAASILPKIFCFITKKCLithobates vaillanti (Ranidae)Staphylococcus aureus3No entry Found
Staph. P 388 LR2RIKRFWPVVIRTVVAGYNLYRAIKKPhasianus colchicusStaphylococcus aureus2No entry Found
Staph. P 389 RL1IKRFWPVVIRTVVAGYNLYRAIKKKPhasianus colchicusStaphylococcus aureus0,94No entry Found
Staph. P 390 Esculentin-1-OA6GLFSKFAGKGIKNFLNKGVKHIGKEodorous frogStaphylococcus aureus1No entry Found
Staph. P 391 CPF-SP1GFLGPLLKLGLKGVAKVLPHLIPSRQQSilurana paratropicalisStaphylococcus aureus6No entry Found
Staph. P 392 CPF-SP2GFLGPLLKLGLKGAAKLLPQLLPSRQQSilurana paratropicalisStaphylococcus aureus6No entry Found
Staph. P 393 CPF-P2GLASFLGKALKAGLKIGSHLLGGAPQQXenopus petersii Staphylococcus aureus6No entry Found
Staph. P 394 CPF-P3GFGSFLGKALKAALKIGANVLGGAPQQXenopus petersii Staphylococcus aureus6No entry Found
Staph. P 395 CPF-P4GFGSFLGKALKAALKIGANVLGGAPEQXenopus petersii Staphylococcus aureus6No entry Found
Staph. P 396 CPF-M1GLGSLLGKAFKFGLKTVGKMMAGAPREQXenopus muelleriStaphylococcus aureus6No entry Found
Staph. P 397 CPF-MW1GLGSLLGKAFKFGLKTVGKMMGGAPREQXenopus muelleriStaphylococcus aureus6No entry Found
Staph. P 398 CPF-MW2GLGSLLGKAFKFGLKTVGKMMGGAPREEXenopus muelleriStaphylococcus aureus6No entry Found
Staph. P 399 Odorranain-F-OA1GFMDTAKNVAKNMAGNLLDNLKCKITKACChinese odorous frogsStaphylococcus aureus0,57No entry Found
Staph. P 400 Odorranain-F-OA2GFMDTAKNVAKNMAVTLLDNLKCKITKACChinese odorous frogsStaphylococcus aureus0,87No entry Found
Staph. P 401 Odorranain-F-OA3GFMDTAKNVAKNEAGNLLDNLKCKITKACChinese odorous frogsStaphylococcus aureus1No entry Found
Staph. P 402 Odorranain-F-OA4GFMATAKNVAKNMDVTLLDNLKCKITKACChinese odorous frogsStaphylococcus aureus0,94No entry Found
Staph. P 403 Odorranain-F-OW1GFMNTAKNVAKNVAVTLLDNLKCKITGGCChinese odorous frogsStaphylococcus aureus4No entry Found
Staph. P 404 Brevinin-2-OA1GILDTFKNMALNAAKSAGVSVLNALSCKLSKTCChinese Odorous FrogsStaphylococcus aureus2No entry Found
Staph. P 405 Brevinin-2-OA2GLLDTFKNMALNAAKSAGVSVLNALSCKLSKTCChinese Odorous FrogsStaphylococcus aureus1No entry Found
Staph. P 406 Brevinin-2-OA3GLLDTFKNMAINAAHGAGVSVLNALSCKLKKTCChinese Odorous FrogsStaphylococcus aureus1No entry Found
Staph. P 407 Brevinin-2-OA4GLLDTFKNLALNAAESAGVSVLNSLSCKLSKTCChinese Odorous FrogsStaphylococcus aureus2No entry Found
Staph. P 408 Brevinin-2-OA5GLLDGILNANFNAAKSAGTSVLNALSCKLSKTCChinese Odorous FrogsStaphylococcus aureus6No entry Found
Staph. P 409 Brevinin-2-OA6GVLATVKNLLIGTGDGAAQSVLKTLSCKLSNDCChinese Odorous FrogsStaphylococcus aureus5No entry Found
Staph. P 410 Brevinin-2-OA7GVLGTVKDLLIGAGKSAAQSTLKTLSCKISNDCChinese Odorous FrogsStaphylococcus aureus2No entry Found
Staph. P 411 Brevinin-2-OA8GVLATVKNLLNGTGDGAAQSVLKTLSCKLSNDCChinese Odorous FrogsStaphylococcus aureus0,81No entry Found
Staph. P 412 Brevinin-2-OR1SVLGTVKDLLIGAGKSAAQSVLTALSCKLSNSCChinese Odorous FrogsStaphylococcus aureus2No entry Found
Staph. P 413 Brevinin-2-OR2GLLDTIKNMALNAAKSAGVSVLNSLSCKLSKTCChinese Odorous FrogsStaphylococcus aureus2No entry Found
Staph. P 414 Brevinin-2-OR3GLIDTIKNMALNAAKSAGVSVLNTLSCKLSKTCChinese Odorous FrogsStaphylococcus aureus4No entry Found
Staph. P 415 Brevinin-2-OR4SVLGTVKDLLIGAGKSAAQSVLTANSCKLSNSCChinese Odorous FrogsStaphylococcus aureus1No entry Found
Staph. P 416 Brevinin-2-OR5SFLDTLKNLAISAAKGAGQSVLSTLSCKLSETCChinese Odorous FrogsStaphylococcus aureus1No entry Found
Staph. P 417 Brevinin-2-OR6GLLDTIKNMALNAAKSAGVSVLNSLSCKDSKTCChinese Odorous FrogsStaphylococcus aureus1No entry Found
Staph. P 418 Brevinin-2-OR7GLLDTIKNMALNAAKSAGVSVLNTLSCKLSKTCChinese Odorous FrogsStaphylococcus aureus2No entry Found
Staph. P 419 Brevinin-2-OR8SFLDTLKNLAISAAKGAGQSVLSTLSCKLSKTCChinese Odorous FrogsStaphylococcus aureus3No entry Found
Staph. P 420 Brevinin-2-OR9SFLSTFKELAINAAKNAGQSILHTLSCKLDKTCChinese Odorous FrogsStaphylococcus aureus2No entry Found
Staph. P 421 Brevinin-2-OR10SFLSTFKELAINAAKNAGQSLLHTLSCKLDKTCChinese Odorous FrogsStaphylococcus aureus2No entry Found
Staph. P 422 Brevinin-2-OW1SVMGTVKDLLIGAGKSAAQSVLKSLSCKISNDCChinese Odorous FrogsStaphylococcus aureus2No entry Found
Staph. P 423 Brevinin-2-OW2SVMGTVKDLLIGAGKSAAQSVLKSLSCKLSNDCChinese Odorous FrogsStaphylococcus aureus0,67No entry Found
Staph. P 424 Brevinin-2-OW3SVMGTVKDLLIGAGKSAAQSVLKALSCKLSKDCChinese Odorous FrogsStaphylococcus aureus2No entry Found
Staph. P 425 Rugosin-RN3SIRDKIKTIAIDLAKSAGMGILKTLICKLDKSCRana nigrovittata ( frog) Staphylococcus aureus3No entry Found
Staph. P 426 Rugosin-RN1SIRDKIKTIAIDLAKSAGTGVLKTLICKLDKSCRana nigrovittata ( frog) Staphylococcus aureus0,95No entry Found
Staph. P 427 Rugosin-RN5SIRDKIKTIAIDLAKSAGTGVLKTLICKLNKSCRana nigrovittata ( frog) Staphylococcus aureus3No entry Found
Staph. P 428 Brevinin-2RTaGLMSTLKDFGKTAAKEIAQSLLSTASCKLAKTCAmolops ricketti (Ranidae)Staphylococcus aureus3 D1MIZ7
Staph. P 429 HlMS-defensinRRCARMYPGSTGYCQGFRCMCDTHIPIRRPPFIMGHaemaphysalis longicornisStaphylococcus aureus4No entry Found
Staph. P 430 temporin-CG1FLPFVGNLLKGLLAmolops chunganensis ( frog)Staphylococcus aureus9 E1AWD7
Staph. P 431 Protonectarina-MPINWKALLDAAKKVLsynthesizedStaphylococcus aureus2No entry Found
Staph. P 432 Parapolybia-MPINWKKMAATALKMIsynthesizedStaphylococcus aureus1No entry Found
Staph. P 433 Asn-2-Polybia-MP IINWKKLLDAAKQILsynthesizedStaphylococcus aureus4No entry Found
Staph. P 434 HPA3NT3FKRLKKLFKKIWNWKsynthesizedStaphylococcus aureus2No entry Found
Staph. P 435 F1AAKRLKKLFKKIWNWKsynthesizedStaphylococcus aureus2No entry Found
Staph. P 436 F8AFKRLKKLAKKIWNWKsynthesizedStaphylococcus aureus4No entry Found
Staph. P 437 A2AKRLKKLAKKIWKWKsynthesizedStaphylococcus aureus4No entry Found
Staph. P 438 alyteserin-2MaFIGKLISAASGLLSHLAlytes maurusStaphylococcus aureus10No entry Found
Staph. P 439 brevinin-1CG2FLPIVAGLAANFLPKIVCKITKKCAmolops chunganensis ( frog) Staphylococcus aureus9 E1AWD5
Staph. P 440 brevinin-1CG4FLSTLLNVASKVVPTLFCKITKKCAmolops chunganensis ( frog) Staphylococcus aureus9 E1AWD3
Staph. P 441 brevinin-1CG5FLPMLAGLAANFLPKIVCKITKKCAmolops chunganensis ( frog) Staphylococcus aureus9 E1B228
Staph. P 442 [Pro3]TLFVPWFSKFLGRILsynthesizedStaphylococcus aureus2No entry Found
Staph. P 443 UyCT5IWSAIWSGIKGLL Urodacus yaschenkoi (Australian scorpion)Staphylococcus aureus1 L0GAZ8
Staph. P 444 3IQ1ANVGFVIQLQARLRGFLVRQKFAsynthesizedStaphylococcus aureus4No entry Found
Staph. P 445 3IQ2TWLPAVIKIQAHWRGYRQRKIYLsynthesizedStaphylococcus aureus5No entry Found
Staph. P 446 Esculentin-2CHaGFSSIFRGVAKFASKGLGKDLAKLGVDLVACKISKQCLithobates chiricahuensis (Ranidae)Staphylococcus aureus5No entry Found
Staph. P 447 Esculentin-2PGIFSLIKGAAKVVAKGLGKEVGKFGLDLMACKVTNQCRana versabilisStaphylococcus aureus2 P82846
Staph. P 448 Esculentin-2VGIFTLFKGAAKLLGKTLAKEAGKTGLELMACKVTNQCRana schmackeriStaphylococcus aureus4No entry Found
Staph. P 449 Esculentin-2ALaGIFALIKTAAKFVGKNLLKQAGKAGLEHLACKANNQC Amolops loloensis (frog)Staphylococcus aureus0,45No entry Found
Staph. P 450 Esculentin-2ALbGIFSLIKTAAKFVGKNLLKQAGKAGVEHLACKANNQC Amolops loloensis (frog)Staphylococcus aureus0,23No entry Found
Staph. P 451 Esculentin-2-OA1GIFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC Amolops loloensis (frog) Staphylococcus aureus0,77No entry Found
Staph. P 452 Esculentin-2-OA2GLFTLIKGAAKLIGKTTAKEAGKTGKLEMACKITNQC Amolops loloensis (frog) Staphylococcus aureus0,4No entry Found
Staph. P 453 Esculentin-2-OR1GVFTLIKGATQLIGKTLGKELGKTGLELMACKITNQCsynthesizedStaphylococcus aureus4No entry Found
Staph. P 454 Esculentin-2-OR2GVFTLIKGATQLIGKTLGKEVGKTGLELMACKITKQCsynthesizedStaphylococcus aureus0,74No entry Found
Staph. P 455 Esculentin-2-OR3GVFTLLKGATQLIGKTLGKELGKTGLELMACKITNQCsynthesizedStaphylococcus aureus1No entry Found
Staph. P 456 Esculentin-2-OR4GVFTLIKGATQLIGKTLGKELGKTGLELMACKITEQCsynthesizedStaphylococcus aureus0,65No entry Found
Staph. P 457 Esculentin-2-OR5GVFTLIKGATQLIGKTLGKELGKTGLEIMACKITKQCsynthesizedStaphylococcus aureus3No entry Found
Staph. P 458 Brevinin-2CEGLLSVFKGVLKTAGKNVAKNVAGSLLDQLKCKISGGC, Rana chensinensis (Skin of the Chinese Brown Frog) Staphylococcus aureus2 A0A0R8YF76
Staph. P 459 Odorranain-P1aVIPFVASVAAETMQHVYCAASKKMLKLNWKSSDVENHLAKCOdorrana grahamiStaphylococcus aureus0,57 A6MBQ0
Staph. P 460 Esculentin-1-OR2KISGKAIKNLFIKGAKNVGKEVGMDVVRTGIDVVGCKIKGECsynthesizedStaphylococcus aureus1No entry Found
Staph. P 461 Cg-Defh1GFGCPRDQYKCNSHCQSIGCRAGYCDAVTLWLRCTCTDCNGKKCrassostrea gigasStaphylococcus aureus0,5No entry Found
Staph. P 462 Cg-Defh2GFGCPGDQYECNRHCRSIGCRAGYCDAVTLWLRCTCTGCSGKKCrassostrea gigasStaphylococcus aureus0,12No entry Found
Staph. P 463 Esculentin-1SGLFSKFAGKGIKNMIIKGIKGIGKEVGMDVIRTGIDVAGCKIKGECRana esculentaStaphylococcus aureus3No entry Found
Staph. P 464 Esculentin-1VGIFSKFAGKGIKDLIIKGVKGIAKEAGMDVIRTGIDIAGCKIKGECRana esculentaStaphylococcus aureus5No entry Found
Staph. P 465 Esculentin-1-OA1GLFSKFVGKGIKNFLIKGVKHIGKEVGMDVIRVGIDVAGCKIKGVCsynthesizedStaphylococcus aureus0,17No entry Found
Staph. P 466 Esculentin-1-OA2GLFSKFSGKGIKNFLIKGVKHIGKEVGMDVIRTGIDVAGCKIKGECsynthesizedStaphylococcus aureus0,19No entry Found
Staph. P 467 Esculentin-1-OA3GLFSKFAGKGIKDLIFKGVKHIGKEVGMDVIRTGIDVAGCKIKGECsynthesizedStaphylococcus aureus0,78No entry Found
Staph. P 468 Esculentin-1-OA4GLFTKFAGKGIKDLIFKGVKHIGKEVGMDVIRTGIDVAGCKIKGECsynthesizedStaphylococcus aureus0,41No entry Found
Staph. P 469 Esculentin-1-OA5GLFSKFAGKGIKNFLIKGVKHIGKEVGMDVIRTGIDVAGCKIKGECsynthesizedStaphylococcus aureus0,25No entry Found
Staph. P 470 Esculentin-1-OR1GIFSKISGKAIKNLFIKGAKNVGKEVGMDVVRTGIDVVGCKIKGECsynthesizedStaphylococcus aureus0,64No entry Found
Staph. P 471 Esculentin-1-OR3GIFSKISGKAIKNLFIKGAKNVGKRVGMDVVRTGMDVVGCKIKGECsynthesizedStaphylococcus aureus2No entry Found
Staph. P 472 Esculentin-1-OR4GIFSKISGKAIKNLFIKGAENVGKHVGMDVVRTGIDVVGCKIKGECsynthesizedStaphylococcus aureus1No entry Found
Staph. P 473 Esculentin-1-OR5GIFSKISGKAIKNLFIKGAKNVGKEVGMDVVRTGMDVVGCKIKGECsynthesizedStaphylococcus aureus0,59No entry Found
Staph. P 474 Cathelicidin-ALRRSRRGRGGGRRGGSGGRGGRGGGGRSGAGSSIAGVGSRGGGGGRHYAAmolops loloensisStaphylococcus aureus0,87 I1T028
Staph. P 475 CADKWKLFKKIEKVGQRVDAVISAGPAVATVAQAATALAKbiosynthesizedStaphylococcus aureus0,29No entry Found
Staph. P 476 esculentin-2CG1SLFSIFKTAAKFVGKNLLKQAGKAGLETLACKAKNECAmolops chunganensis (frog )Staphylococcus aureus9 E1B230
Staph. P 477 Px-cec1KPFKKLEKVGRNIRDGIIKAGPAVAVIGQATSIARPTGKPlutella xylostella LStaphylococcus aureus2No entry Found
Staph. P 478 CoprisinVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN Copris tripartitus (dung beetle)Staphylococcus aureus2 A9XFZ7