ID Peptide Name Sequence Producer organism Target organism MIC value(μM) UniProt
MRSA.P 1 mod-defensinAWLLAIRKRinsectMRSA21.84No entry Found
MRSA.P 2 mod-defensin-2ALYLAIRKRinsectMRSA26.74No entry Found
MRSA.P 3 Mastoparan-MINLKAIAALAKKLLinsectMRSA USA300 LA>100No entry Found
MRSA.P 4 Ranatuerin-9FLFPLITSFLSKVLLithobates catesbeiana (American bullfrog) (Rana catesbeiana) ( frog) MRSA USA300 LA 50 P82824
MRSA.P 5 Hyposin-5FRPALIVRTKGTRLPhyllomedusa azurea (Orange-legged monkey frog) (Phyllomedusa hypochondrialis azurea)MRSA USA300 LA > 30 P84958
MRSA.P 6 Metalnikowin-IVDKPDYRPRPRPPNMPalomena prasina (Green shield bug) (Cimex prasinus)MRSA USA300 LA > 100 P80408
MRSA.P 7 ch-A-IndolicidinICLKKWPWWPWRRCKXbovineMRSA7.28No entry Found
MRSA.P 8 MelectinGFLSILKKVLPKVMAHMKMelecta albifrons (Cuckoo bee) (Melecta punctata)MRSA USA300 LA 12.5?25 P86170
MRSA.P 9 BMAP-27GRFKRFRKKFKKLFKKLSBos taurus (Bovine)MRSA4 P54228
MRSA.P 10 Apidaecin-IAGNNRPVYIPQPRPPHPRIApis mellifera (Honeybee)MRSA USA300 LA > 100 Q06601
MRSA.P 11 myeloid-27GRFKRFRKKFKKLFKKLSbovineMRSA4No entry Found
MRSA.P 12 Parasin-IKGRGKQGGKVRAKAKTRSSSilurus asotus (Amur catfish) (Parasilurus asotus)MRSA USA300 LA > 84 Q8JI24
MRSA.P 13 Ascaphin-8GFKDLLKGAAKALVKTVLFAscaphus truei (Coastal tailed frog)MRSA USA300 LA3.1 P0CJ32
MRSA.P 14 DrosocinGKPRPYSPRPTSHPRPIRVDrosophila simulans (Fruit fly)MRSA USA300 LA > 100 Q6XMH8
MRSA.P 15 Styelin-AGFGKAFHSVSNFAKKHKTAStyela clava (Sea squirt)MRSA USA300 LA > 100 P81469
MRSA.P 16 Latarcin-3aSWKSMAKKLKEYMEKLKQRALachesana tarabaevi (Spider)MRSA USA300 LA >100 Q1ELU3
MRSA.P 17 Pilosulin-1GLGSVFGRLARILGRVIPKVMyrmecia pilosula (Jack jumper ant) (Australian jumper ant)MRSA LT1334 MRSA LT1338 1. 5; 3 Q07932
MRSA.P 18 MisgurinRQRVEELSKFSKKGAAARRRKMisgurnus anguillicaudatus (Oriental weatherloach) (Cobitis anguillicaudata)MRSA USA300 LA > 84 P81474
MRSA.P 19 PGLaGMASKAGAIAGKIAKVALKALXenopus laevis (African clawed frog)MRSA USA300 LA 25 Q99134
MRSA.P 20 Buforin-IITRSSRAGLQFPVGRVHRLLRKBufo gargarizans (Asian toad) (Bufo bufo gargarizans)MRSA USA300 LA >71 P55897
MRSA.P 21 pleurocidin-WFXRSTEDIIKSISGGGFLNAMNAPseudopleuronectes americanus (Winter flounder) (Pleuronectes americanus)MRSA clinical isolate > 29.09 P81941
MRSA.P 22 Brevinin-2GIWDTIKSMGKVFAGKILQNLPelophylax porosus brevipodus (Nagoya Daruma pond frog) (Rana brevipoda porsa)MRSA USA300 LA 25 P32424
MRSA.P 23 Maculatin-1.3GLLGLLGSVVSHVVPAIVGHFLitoria genimaculata (Green-eyed tree frog)MRSA USA300 LA 6.2 P82066
MRSA.P 24 Piscidin-1FFHHIFRGIVHVGKTIHRLVTGEpinephelus malabaricus (Malabar grouper) (Holocentrus malabaricus)MRSA USA300 LA 3.1 F1CNA8
MRSA.P 25 Brevenin-1TSaFLGSIVGALASALPSLISKIRNfrogMRSA T7/20 25No entry Found
MRSA.P 26 IsracidinRPKHPIKHQGLPQEVLNENLLRFBos taurus [Bovine]MRSA USA300 LA > 100No entry Found
MRSA.P 27 Clavanin-BVFQFLGRIIHHVGNFVHGFSHVFStyela clava (Sea squirt)MRSA USA300 LA >100 P80711
MRSA.P 28 MoronecidinFFHHIFRGIVHVGKTIHKLVTGGMorone saxatilis (Striped bass) (Perca saxatilis)MRSA1.25-2.5 Q8UUG0
MRSA.P 29 CryptoninGLLNGLALRLGKRALKKIIKRLCRCryptotympana dubia (Korean horse cicada)MRSA9.18 P85028
MRSA.P 30 Ponericin-L2LLKELWTKIKGAGKAVLGKIKGLLPachycondyla goeldii (Ponerine ant)MRSA USA300 LA 85 P82422
MRSA.P 31 Pseudin-1GLNTLKKVFQGLHEAIKLINNHVQPseudis paradoxa (Paradoxical frog)MRSA USA300 LA > 100 P83188
MRSA.P 32 PlnGAWKNFWSSLRKGFYDGEAGRAIRRLactobacillus plantarumMRSA USA300 LA > 38.9No entry Found
MRSA.P 33 PleurocidinGWGSFFKKAAHVGKHVGKAALTHYLPseudopleuronectes americanus (Winter flounder) (Pleuronectes americanus)MRSA clinical isolate 2.93 81941
MRSA.P 34 SpinigerinHVDKKVADKVLLLKQLRIMRLLTRLPseudacanthotermes spinigerMRSA USA300 LA > 81 P82357
MRSA.P 35 Lycotoxin-IIWLTALKFLGKHAAKHLAKQQLSKLHogna carolinensis (Carolina wolf spider) (Lycosa carolinensis)MRSA USA300 LA 3.1 P61507
MRSA.P 36 mBMAP28GGLRSLGRKILRAWKKYGPQATPATRQBos taurus [Bovine]MRSA> 64 P54229
MRSA.P 37 Cathelicidin-5GGLRSLGRKILRAWKKYGPIIVPIIRIG Bos taurus (Bovine)MRSA4 P54229
MRSA.P 38 Dermaseptin-01GLWSTIKQKGKEAAIAAAKAAGQAALGALPhyllomedusa oreades (Orange-legged leaf frog) (Monkey frog)MRSA12.83 P83637
MRSA.P 39 Flowlicidin-2LVQRGRFGRFLRKIRRFRPKVTITIQGSARFGGallus gallus (Chicken).MRSA 43300 MRSA BAA-39 0.33 0.66 Q2IAL7
MRSA.P 40 cathelin-AMPGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEMus musculus (Mouse)MRSA64 P51437
MRSA.P 41 Brevinin-2TSaGIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGCRana tsushimensisMRSA T7/20 25No entry Found
MRSA.P 42 Ostricacin-1LFCRKGTCHFGGCPAHLVKVGSCFGFRACCKWPWDVStruthio camelus (Common ostrich)MRSA 1056 0.309 P85113
MRSA.P 43 cathelin-AMP2ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEMus musculus (Mouse)MRSA64 P51437
MRSA.P 44 Ostricacin-3IPRPLDPCIAQNGRCFTGICRYPYFWIGTCRNGKSCCRRRStruthio camelus (Common ostrich)MRSA 1056 0.59 P85115
MRSA.P 45 Ostricacin-2APGNKAECEREKGYCGFLKCSFPFVVSGKCSRFFFCCKNIWStruthio camelus (Common ostrich)MRSA 1056 0.26 P85114
MRSA.P 46 Ostricacin-4LPVNEAQCRQVGGYCGLRICNFPSRFLGLCTRNHPCCSRVWVStruthio camelus (Common ostrich)MRSA 1056 3.34 P85116
MRSA.P 47 Synthetic_5RLKLLLRLKsynthesizedMRSA2No entry Found
MRSA.P 48 Modified defensin_1ALRLAIRKRcoconut rhinoceros beetleMRSA4No entry Found
MRSA.P 49 Synthetic_4RLKLLLLRLKsynthesizedMRSA2No entry Found
MRSA.P 50 Synthetic_3RLKLLLLLRLKsynthesizedMRSA1No entry Found
MRSA.P 51 Synthetic_2KLKLLLLLKLKsynthesizedMRSA2No entry Found
MRSA.P 52 Synthetic_1KLKLLLLLShynthetizedMRSA8No entry Found
MRSA.P 53 IsCTf_5ILGKIWKIKKLFOpisthacanthus madagascariensis ( scorpion) MRSA CCARM 3001 and MRSACCARM 3543No entry Found
MRSA.P 54 CP11CNILKKWPWWPWRRKsynthesizedStaphylococcus aureus SAP0017 MRSA8No entry Found
MRSA.P 55 Cytotoxic linear peptide IsCTILGKIWEGIKSLFOpisthacanthus madagascariensis (scorpion)MRSACCARM 3001 and CCARM 35432No entry Found
MRSA.P 56 IsCTf_2ILGKILEGIKSLFOpisthacanthus madagascariensis ( scorpion) MRSA CCARM 3001 and MRSACCARM 35434No entry Found
MRSA.P 57 Vespid chemotactic peptide 5eFLPIIAKLLGGLLOpisthacanthus madagascariensis ( scorpion) MRSA CCARM 3001 and MRSACCARM 35435No entry Found
MRSA.P 58 Indolicidin with P to A substiILAWKWAWWAWRRsynthesizedStaphylococcus aureusSAP0017 MRSAb 64 8 8 16 4 164No entry Found
MRSA.P 59 Temporin 1VbFLSIIAKVLGSLFRana virgatipes ( frog) Staphylococcus aureus (MRSA) T7/208No entry Found
MRSA.P 60 MucroporinLFGLIPSLIGGLVSAFKLychas mucronatusStaphylococcus aureus P1381 (MRSA), P1386 (MRSA), P1374 (MRSA) 10No entry Found
MRSA.P 61 BMAP-28(1-18)GGLRSLGRKILRAWKKYGsynthesizedStaphylococcus aureus(MRSA2No entry Found
MRSA.P 62 XT 7GLLGPLLKIAAKVGSNLLfrog, Xenopus tropicalis (Pipidae) (frog,)Staphylococcus aureus MRSA5No entry Found
MRSA.P 63 PGPGRFRRLGRKFKKLFKKYGPsynthesizedStaphylococcus aureus MRSA8No entry Found
MRSA.P 64 PMAP-36GRFRRLRKKTRKRLKKIGKVsynthesizedS. aureus SA-62 (MRSA)6No entry Found
MRSA.P 65 PGAaGILSKLGKALKKAAKHAAKAsynthesizedMRSA8No entry Found
MRSA.P 66 Nigrocin-2ISaGIFSTVFKAGKGIVCGLTGLC Odorrana ishikawae (frog)MRSA3No entry Found
MRSA.P 67 Nigrocin-2ISbGILGTVFKAGKGIVCGLTGLC Odorrana ishikawae (frog)MRSA3No entry Found
MRSA.P 68 Kassinatuerin-1GFMKYIGPLIPHAVKAISDLIsynthesizedMRSA6No entry Found
MRSA.P 69 pleurocidin-like peptide GcSc4B7FWGKLLKLGMHGIGLLHQHLGFlatfish GenesMRSA1No entry Found
MRSA.P 70 PGYaGLLRRLRDFLKKIGEKFKKIGYsynthesizedMRSA4No entry Found
MRSA.P 71 PexigananGIGKFLKKAKKFGKAFVKILKKsynthesizedMRSA4No entry Found
MRSA.P 72 Clavanin-AVFQFLGKIIHHVGNFVHGFSHVFsynthesizedMRSA0,7No entry Found
MRSA.P 73 Clavanin akVFQFLGKIIKKVGNFVKGFSKVFsynthesizedMRSA4No entry Found
MRSA.P 74 pleurocidin-like peptide Hb26FLGLLFHGVHHVGKWIHGLIHGHHFlatfish GenesMRSA2No entry Found
MRSA.P 75 Winter flounder 3FLGALIKGAIHGGRFIHGMIQNHHFlatfish GenesMRSA9No entry Found
MRSA.P 76 CryptoninGLLNGLALRLGKRALKKIIKRLCRCryptotympana dubiaMRSA7No entry Found
MRSA.P 77 Pleurocidin-like peptide WF4GWGSIFKHGRHAAKHIGHAAVNHYLFlatfish GenesMRSA9No entry Found
MRSA.P 78 pleurocidin-like peptide AP2GWKKWFNRAKKVGKTVGGLAVDHYLGFlatfish GenesMRSA4No entry Found
MRSA.P 79 pleurocidin-like peptide GcSc4C5GWGSIFKHIFKAGKFIHGAIQAHNDGFlatfish GenesMRSA4No entry Found
MRSA.P 80 Winter flounder 1a1GRRKRKWLRRIGKGVKIIGGAALDHLFlatfish GenesMRSA2No entry Found
MRSA.P 81 XT 1GFLGPLLKLAAKGVAKVIPHLIPSRQQXenopus tropicalis (Pipidae)MRSA5No entry Found
MRSA.P 82 Cathelicidin 6GRFKRFRKKFKKLFKKLSPVIPLLHLGsynthesizedMRSA3No entry Found
MRSA.P 83 LLP Lentivirus lytic peptideRVIEVVQGACRAIRHIPRRIRQGLERILHuman Immunodeficiency Virus Type 1MRSA3No entry Found
MRSA.P 84 SMAP29RGLRRLGRKIAHGVKKYGPTVLRIIRIAGbiosynthesizedMRSA1No entry Found
MRSA.P 85 PhD-4ACYCRIPACFAGERRYGTCFYLGRVWAFCCPapio hamadryasMRSA4No entry Found
MRSA.P 86 Brevinin-2-RN1GAFGNFLKGVAKKAGLKILSIAQCKLSGTCRana nigrovittata ( frog) MRSA0,7No entry Found
MRSA.P 87 Brevinin-2-RN2GAFGNFLKGVAKKAGLKILSIAQCKLFGTCRana nigrovittata ( frog) MRSA1No entry Found
MRSA.P 88 Cecropin P1SWLSKTAKKLENSAKKRISEGIAIAIQGGPRsynthesizedMRSA1No entry Found
MRSA.P 89 Dolabellanin-B2SHQDCYEALHKCMASHSKPFSCSMKFHMCLQQQDolabella auriculariaMRSA7No entry Found
MRSA.P 90 Brevinin-2ISbSFLTTFKDLAIKAAKSAGQSVLSTLSCKLSNTCOdorrana ishikawaeMRSA6No entry Found
MRSA.P 91 SMAP-34GLFGRLRDSLQRGGQKILEKAERIWCKIKDIFRbiosynthesizedMRSA2No entry Found
MRSA.P 92 Bmap-34GLFRRLRDSIRRGQQKILEKARRIGERIKDIFRGsynthesizedMRSA3No entry Found
MRSA.P 93 Esculentin-2ISaGIFSLIKGAAKLITKTVAKEAGKTGLELMACKVTNQCOdorrana ishikawae ( frog)MRSA3No entry Found
MRSA.P 94 Osp-2APGNKAECEREKGYCGFLKCSFPFVVSGKCSRFFFCCKNIWostrich heterophilsMRSA0,2No entry Found
MRSA.P 95 MoricinAKIPIKAIKTVGKAVGKGLRAINIASTANDVFNFLKPKKRKASpodoptera litura ( insect)MRSA0,7No entry Found
MRSA.P 96 Esculentin-1ISaGIFSKFAGKGIKNLLVKGVKNIGKEVGMDVIRTGIDIAGCKIKGEC Odorrana ishikawae (frog)MRSA3No entry Found
MRSA.P 97 Esculentin-1ISbRIFSKIGGKAIKNLILKGIKNIGKEVGMDVIRTGIDVAGCKIKGEC Odorrana ishikawae (frog)MRSA3No entry Found
MRSA.P 98 LongicornsinDFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPLRPPFMVGHaemaphysalis longicornis (salivary glands)MRSA0,16No entry Found
MRSA.P 99 Nigrocin-2IScGILSTVFKAGKGIVCGLSGLCOdorrana ishikawae ( frog)MRSA3No entry Found
MRSA.P 100 Brevinin-1ISaFLPGVLRLVTKVGPAVVCAITRNCOdorrana ishikawae ( frog)MRSA3No entry Found
MRSA.P 101 DASamP1FFGKVLKLIRKIFDatabase screening and synthesizedMRSA3No entry Found
MRSA.P 102 DASamP2IKWKKLLRAAKRILDatabase screening and synthesizedMRSA6No entry Found
MRSA.P 103 PGLa-HKIAKVALKALXenopus laevisMRSA6No entry Found
MRSA.P 104 Temporin-1DRa_1HFLGTLVNLAKKILRana draytoniiMRSA6No entry Found
MRSA.P 105 Nigroain-C2FKTWKRPPFQTSCWGIIKERana nigrovittataMRSA10No entry Found
MRSA.P 106 Hfp1SFKKFWGGVKAIFKGARKGWKBioinformatics study MRSA2No entry Found
MRSA.P 107 Hfp2FFKKFWGGVKAIFKGARKGWKBioinformatics study MRSA2No entry Found
MRSA.P 108 Hfp3SVKKFWGGVKAIFKGARKGLKBioinformatics study MRSA8No entry Found
MRSA.P 109 Gaegurin-RN5FLGPIIKIATGILPTAICKFLKKCRana nigrovittata ( frog) MRSA1No entry Found
MRSA.P 110 Palustrin-2ISb-des-C7 GLWNSIKIAGKKLFVNVLDKIRCKVAGGCOdorrana ishikawae ( frog)MRSA2No entry Found
MRSA.P 111 Palustrin-2ISb-des-C7-4DGLWDSIKIAGKKLFVNVLDKIRCKVAGGCOdorrana ishikawae ( frog)MRSA3No entry Found
MRSA.P 112 Palustrin-2ISb-des-C7-12NGLWNSIKIAGKNLFVNVLDKIRCKVAGGCOdorrana ishikawae ( frog)MRSA3No entry Found
MRSA.P 113 Palustrin-2ISb-des-C7-23,29SGLWNSIKIAGKKLFVNVLDKIRSKVAGGSOdorrana ishikawae ( frog)MRSA6No entry Found
MRSA.P 114 Nigroain-K2SLWETIKNAGKGFILNILDKIRCKVAGGCKTRana nigrovittata ( frog) MRSA2No entry Found
MRSA.P 115 R-BP100RRLFRRILRYLsynthesizedMRSA3No entry Found
MRSA.P 116 RW-BP100RRLFRRILRWLsynthesizedMRSA0,3No entry Found
MRSA.P 117 temporin-SHdFLPAALAGIGGILGKLFPelophylax saharicus ( frog)MRSA6No entry Found
MRSA.P 118 Palustrin-2ISb + 3aaGLWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVEYHKOdorrana ishikawae ( frog)MRSA6No entry Found